DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and AT4G30320

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:133 Identity:41/133 - (30%)
Similarity:58/133 - (43%) Gaps:20/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 MREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWST----APLDADDGDFPSRIQ 125
            ::.:.||.:||..||.||:  |.|.|...|.:....|:||  .|.:    .|..|..|       
plant    43 LKPLKWDAKLARYAQWWAN--QRRGDCALTHSNGPYGENL--FWGSGNRWGPSQAAYG------- 96

  Fly   126 SWFNEVQKYSF--GDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGY 188
             |.:|.:.|::  ....|...|||:|:||..|..:||.:.......  .....|||.|.||.:|.
plant    97 -WLSEARSYNYRSNSCNSEMCGHYTQIVWKNTQKIGCAHVICNGGG--GVFLTCNYDPPGNFLGR 158

  Fly   189 NPY 191
            .||
plant   159 KPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 34/120 (28%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 39/131 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.