DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and AT4G25790

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_194309.1 Gene:AT4G25790 / 828684 AraportID:AT4G25790 Length:210 Species:Arabidopsis thaliana


Alignment Length:159 Identity:49/159 - (30%)
Similarity:70/159 - (44%) Gaps:35/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLA 105
            |..||.:|            |...:..:|||.::|:.|..||:  |.|:|...|.:....|:|| 
plant    79 LDPHNTVR------------GGLGLPPLVWDVKIASYATWWAN--QRRYDCSLTHSTGPYGENL- 128

  Fly   106 IIWSTAPLDADDGDFPS--RIQSWFNEVQKYSF------GDAWSPKTGHYSQLVWGETSLVGCGY 162
             .|.:.      .||.|  .::||..|.:.|:.      ||.   ..|||:|:||.||..:||..
plant   129 -FWGSG------SDFTSTFAVESWTVEAKSYNHMTNTCEGDG---MCGHYTQIVWRETRRLGCAR 183

  Fly   163 AEYKDTSKYNKLYVCNYGPGGNVVGYNPY 191
            ...::.:  .....|||.|.||.||..||
plant   184 VVCENGA--GVFITCNYDPPGNYVGEKPY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 41/146 (28%)
AT4G25790NP_194309.1 CAP_PR-1 76..210 CDD:349400 47/157 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.