DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and AT2G19980

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:189 Identity:47/189 - (24%)
Similarity:80/189 - (42%) Gaps:53/189 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAVLLTTIMIISCEVAFACNGKIIASGITAEERSIILQE------HNRLRQIVATGRYPGQPGAE 63
            |.::||.:.|:..::          .|:.:..|...||.      ||::|..             
plant     7 SFIVLTLLSIVLTQI----------YGLRSFSRMDDLQPAETLAVHNQIRAA------------- 48

  Fly    64 NMREIVWDDELAARAQKWAD----NCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRI 124
                   |.:|||.||::|:    :|..::....     |.|:|:|..| ..|:|...|  |...
plant    49 -------DQKLAAHAQRYANVRSQDCAMKYSTDG-----TYGENIAAGW-VQPMDTMSG--PIAT 98

  Fly   125 QSWFNEVQKYSFG-DAWSPKTGHYSQLVWGETSLVGCGYAE-YKDTSKYNKLYVCNYGP 181
            :.||.|...|::. :..|...|||:|:|..:::.:|||... :|:...:   .||||.|
plant    99 KFWFTEKPYYNYATNKCSEPCGHYTQIVANQSTHLGCGTVRCFKNEYVW---VVCNYAP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 40/154 (26%)
AT2G19980NP_179588.1 SCP 35..165 CDD:294090 39/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.