DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and PR1

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_179068.1 Gene:PR1 / 815949 AraportID:AT2G14610 Length:161 Species:Arabidopsis thaliana


Alignment Length:180 Identity:48/180 - (26%)
Similarity:75/180 - (41%) Gaps:37/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWAD 83
            |..|..|.::......:.....|:.||:.|..|..|  |.|          ||:.:||.|:.:|:
plant    12 VFVALVGALVLPSKAQDSPQDYLRVHNQARGAVGVG--PMQ----------WDERVAAYARSYAE 64

  Fly    84 ----NCQFRHD--PHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF-GDAWS 141
                ||:..|.  |:        |:|||  |.:..|..     .|.:..|.:|...|:: .:..:
plant    65 QLRGNCRLIHSGGPY--------GENLA--WGSGDLSG-----VSAVNMWVSEKANYNYAANTCN 114

  Fly   142 PKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPY 191
            ...|||:|:||.::..:||....   .:....:..|||.|.||.|...||
plant   115 GVCGHYTQVVWRKSVRLGCAKVR---CNNGGTIISCNYDPRGNYVNEKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 38/149 (26%)
PR1NP_179068.1 SCP_PR-1_like 30..161 CDD:240181 43/160 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.