DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and PRB1

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:183 Identity:47/183 - (25%)
Similarity:74/183 - (40%) Gaps:33/183 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAA 76
            |:||..    |..|.::......:.:...:..||:.|..:..|  |.|          ||:.|||
plant     9 ILIILA----ALVGALVVPLKAQDSQQDYVNAHNQARSQIGVG--PMQ----------WDEGLAA 57

  Fly    77 RAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFP--SRIQSWFNEVQKYSFG-D 138
            .|:.:|:  |.:.|.....:|...|:|||         ...||..  :.:..|.||...|::. :
plant    58 YARNYAN--QLKGDCRLVHSRGPYGENLA---------KSGGDLSGVAAVNLWVNEKANYNYDTN 111

  Fly   139 AWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPY 191
            ..:...|||:|:||..:..:||....   .:....:..|||.|.||.....||
plant   112 TCNGVCGHYTQVVWRNSVRLGCAKVR---CNNGGTIISCNYDPPGNYANQKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 36/145 (25%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 40/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.