DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CRISP2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:219 Identity:65/219 - (29%)
Similarity:91/219 - (41%) Gaps:67/219 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRH-DPHRTINRFTMGQN 103
            |:.:||.||:.|:       |.|.||.::.|..|:...||:||:.|..:| ||.........|:|
Human    40 IVNKHNELRKAVS-------PPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGEN 97

  Fly   104 LAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPKT-----GHYSQLVWGETSLVGCG-- 161
            |.       :.:|...:.|.||||::|:..:.:|  ..||:     |||:||||..|..||||  
Human    98 LY-------MSSDPTSWSSAIQSWYDEILDFVYG--VGPKSPNAVVGHYTQLVWYSTYQVGCGIA 153

  Fly   162 YAEYKDTSKYNKLYVCNYGP------------------------------------GGNVVGYN- 189
            |...:|:.||  .|||.|.|                                    |.|:...| 
Human   154 YCPNQDSLKY--YYVCQYCPAMKTYLNKREGINVWKCFLRLRHFQLLRGEQLLTFSGNNMNRKNT 216

  Fly   190 PYEVGKPSCSTYGMKPSSRYQGLC 213
            ||:.|.|....    |....:|||
Human   217 PYQQGTPCAGC----PDDCDKGLC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 52/147 (35%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 53/149 (36%)
Crisp 224..278 CDD:285731 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151112
Domainoid 1 1.000 88 1.000 Domainoid score I7923
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40962
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.