DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:182 Identity:57/182 - (31%)
Similarity:90/182 - (49%) Gaps:27/182 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDP-----HRTINRFT- 99
            |..||.||:.|       ||.|.:|.::.||.:||..|:.|...|:..|:|     :..:..:. 
Mouse    46 LNIHNELRRKV-------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDF 103

  Fly   100 MGQNLAI-IWSTAPLDADDGDFPSRIQSWFNEVQKYSFG-DAWSPKTGHYSQLVWGETSLVGCGY 162
            :|:|:.: ...|.|.|.        :.:|:||.:.::|. :..|...|||:|:||.:|..:||..
Mouse   104 IGENIYLGRIETQPEDV--------VINWYNESKYFNFDFNTCSEMCGHYTQVVWAKTVKIGCAV 160

  Fly   163 AEYKDTSKYNK-LYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLC 213
            :...:...::. |:||||.|.||.:|:.||..| .|||..|.|...  ..||
Mouse   161 SNCPNLKGFSAGLFVCNYSPAGNFIGFRPYTRG-DSCSMCGQKTCE--NSLC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 42/147 (29%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 43/149 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841180
Domainoid 1 1.000 72 1.000 Domainoid score I9265
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43032
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.