DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Glipr2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006238202.1 Gene:Glipr2 / 679819 RGDID:1583669 Length:170 Species:Rattus norvegicus


Alignment Length:158 Identity:42/158 - (26%)
Similarity:69/158 - (43%) Gaps:21/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNL 104
            :|:.||..|      ...|.|..:..:::  :.|....::..|.....:|.|..  :|...|:||
  Rat    29 VLKAHNEYR------AKHGVPPLKLCKKL--NQEAQQYSEALASTRILKHSPES--SRGQCGENL 83

  Fly   105 AIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD-AWSPKTGHYSQLVWGETSLVGCGYAEYKDT 168
            |  |  |..|....:...|   |::|::.|:|.. .::..|||::.:||..|..:|.|.|...|.
  Rat    84 A--W--ASYDQTGKEVADR---WYSEIKSYNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDG 141

  Fly   169 SKYNKLYVCNYGPGGNVVGYNPYEVGKP 196
            |.:   .|..|.|.||:|....:|...|
  Rat   142 SSF---VVARYFPAGNIVNQGFFEENVP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 35/140 (25%)
Glipr2XP_006238202.1 SCP_GAPR-1_like 24..155 CDD:240182 38/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.