DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:292 Identity:73/292 - (25%)
Similarity:112/292 - (38%) Gaps:86/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QPSAVLLTTIMIISCEVAFACNGKIIASGITA----EERSIILQE----HNRLRQIVATGRYPGQ 59
            |.:.|.|..::.: ||:...    ::.||:.|    ||....:.|    ||.||..|    :|  
Mouse    14 QSNYVRLRRVLKL-CELWLL----LVGSGLNAKLPLEEDVDFINEYVGLHNELRGTV----FP-- 67

  Fly    60 PGAENMREIVWDDELAARAQKWADNCQFR--------HDPHRTINRFT-MGQNLAIIWSTAPLDA 115
            ||. |:|.:.||..|:..|:.|...|.:.        |:.|..   || :|:|:   | ..|:  
Mouse    68 PGV-NLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPV---FTEIGENM---W-VGPV-- 122

  Fly   116 DDGDFPSRIQSWFNEVQKYSF-GDAW--SPKTGHYSQLVWGETSLVGCGYAEYKDTSKYN--KLY 175
            :|....:.|:||..|.:.||: .|..  .....||.||||..:..|||..........:.  .|:
Mouse   123 EDFTVTTAIRSWHEERKSYSYLNDTCVEDQNCSHYIQLVWDSSYKVGCAVTSCARAGGFTHAALF 187

  Fly   176 VCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLCAAPGSSPAANSVYGANTIET----YEY 236
            :|||.|||.:. ..||:.|:                .|:..|..........:||:..    |::
Mouse   188 ICNYAPGGTLT-RRPYQAGQ----------------FCSRCGPGDQCTDYLCSNTVRDEATYYQF 235

  Fly   237 GYNSSPSSQTANNNPPTNNINKSQFSYNQPRP 268
            .|            ||          :.:|||
Mouse   236 WY------------PP----------WEKPRP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 45/160 (28%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 46/160 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841184
Domainoid 1 1.000 72 1.000 Domainoid score I9265
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43032
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.