DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and crispl

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:233 Identity:73/233 - (31%)
Similarity:111/233 - (47%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHD--PHRTINRFT 99
            |..||..||.||:       ...|...||.::||.|..|..|.|||::|:..|.  |.|||..|:
 Frog   108 RQSILNVHNELRR-------NANPPPSNMLKMVWSDLAAKSAAKWANSCKQYHSLKPERTIPGFS 165

  Fly   100 MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPKTG----HYSQLVWGETSLVGC 160
            .|:||.:    |...|...|.   |:::::|::.:.:|.. :.:.|    |::|::|..:.||||
 Frog   166 CGENLFM----ASYKASWEDV---IRAFYSEIEDFLYGKG-AKEVGLQILHFTQVMWFSSWLVGC 222

  Fly   161 GYAEYKDTSKYNKLY-VCNYGPGGNV--VGYNPYEVGKP--SCSTYGMKPSSRYQGLCAAPGSSP 220
            ..|:...|....:.| ||:|.|.||.  ||. ||:.|||  .|.      ||...|||.  ....
 Frog   223 AAAQCPITDHSLEFYFVCHYAPAGNYGNVGI-PYKTGKPCEDCK------SSCENGLCT--NGCN 278

  Fly   221 AANSVYGANTIETYEYGYNSSPSSQTANNNPPTNNINK 258
            ..|.....:|.:|:   .::.|:::  |:.|.|.|..|
 Frog   279 FQNKFSNCDTPDTH---CDTDPTAK--NDCPATCNCLK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 47/149 (32%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 48/151 (32%)
Crisp 261..314 CDD:369954 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4851
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48157
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.