DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and pi15a

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:215 Identity:74/215 - (34%)
Similarity:103/215 - (47%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            |:..:...||..||::|..|.       |.|.||..:||||.||..|::||..|.:.|.| |.:.
Zfish    64 ISQNDMLAILDYHNKVRGKVF-------PPASNMEYMVWDDTLAKTAEQWASTCIWEHGP-RNLL 120

  Fly    97 RFTMGQNLAIIWSTAPLDADDGDFPSRIQ---SWFNEVQKYSFG-----------DAWSPKTGHY 147
            || :||||::         ..|.:.|.:|   .|.:||:.|||.           ..:.|...||
Zfish   121 RF-LGQNLSV---------RTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHY 175

  Fly   148 SQLVWGETSLVGCGYAEYKDTSKYNKLY------VCNYGPGGNVVGYNPYEVGKPSCSTYGMKPS 206
            :|:||..::.|||......:.:.:..::      ||||.|.||.:|..||:||.| ||   |.|.
Zfish   176 TQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVP-CS---MCPP 236

  Fly   207 SRYQGLCAAPGSSPAANSVY 226
            | |.|.|:.....||.||.|
Zfish   237 S-YGGSCSNNMCFPAVNSNY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 50/162 (31%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 50/160 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585655
Domainoid 1 1.000 81 1.000 Domainoid score I8420
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25860
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.