DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and pi15b

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:217 Identity:69/217 - (31%)
Similarity:99/217 - (45%) Gaps:51/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            |:..:...||..||::|..|.       |.|.||..::|||.||..|:.||..|.:.|.|...: 
Zfish    61 ISQSDMIAILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLL- 117

  Fly    97 RFTMGQNLAIIWSTAPLDADDGDFPSRIQ---SWFNEVQKYSFG-----------DAWSPKTGHY 147
            |: :||||::         ..|::.|.:|   .|::||:.|.|.           ..:.|...||
Zfish   118 RY-LGQNLSV---------RTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHY 172

  Fly   148 SQLVWGETSLVGCGY----------AEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYG 202
            :|:||..::.|||..          |.:::.:    ..||||.|.||.:|..||.||.| ||  .
Zfish   173 TQMVWASSNRVGCAIQTCFNMVVWGAVWREAT----YLVCNYSPKGNWIGEAPYRVGVP-CS--A 230

  Fly   203 MKPSSRYQGLCAAPGSSPAANS 224
            ..||  |.|.|:.....||.||
Zfish   231 CPPS--YGGSCSNNMCFPAINS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 47/166 (28%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 47/164 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585654
Domainoid 1 1.000 81 1.000 Domainoid score I8420
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25860
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.