DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:201 Identity:68/201 - (33%)
Similarity:98/201 - (48%) Gaps:28/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GKIIASGIT---AEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQ 86
            ||::....|   .|.::..|..||..|:.|       ||.|.||.::.||..||..|:.|...|:
  Rat    27 GKVLPRVPTINDPEFKNGFLNSHNEARRKV-------QPPASNMNQLSWDKSLAKLAKSWTRECK 84

  Fly    87 FRHDP-----HRTINRFT-MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPKT- 144
            |.|:|     |.....:. :|:|:.:    ..:||...|.   :.||:||.:.|:|.|....|| 
  Rat    85 FSHNPCTSKRHGCTKDYDYIGENIYL----GKIDARPEDV---VFSWYNETKDYNFDDNTCTKTC 142

  Fly   145 GHYSQLVWGETSLVGCGYAEYKDTSKYNK-LYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSR 208
            |||:|:||.:|..:||..:.....:.|:. |:||||.|.||..|..||..|:| ||..|.|..  
  Rat   143 GHYTQVVWAKTLKIGCAISNCPHLTGYSAGLFVCNYVPAGNFQGSKPYIKGEP-CSMCGEKEC-- 204

  Fly   209 YQGLCA 214
            ...||:
  Rat   205 VNSLCS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 49/150 (33%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 51/154 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344588
Domainoid 1 1.000 82 1.000 Domainoid score I8206
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45097
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.