DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Ag5r

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:227 Identity:65/227 - (28%)
Similarity:95/227 - (41%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADN 84
            |.:|........:::.|:..::...|..|..:|.|.......|..|..|.|:||||..|.....:
  Fly    42 ASSCPSDATLLTLSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKS 106

  Fly    85 CQFRHDPHRTINRFT-MGQNLAIIWSTAPLDA----DDGDFPSRIQSWFNEV--QKYSFGDAW-- 140
            ||.:||.....:.|. .|||||.:....||:.    :.|     :..|::|.  .|.::.||:  
  Fly   107 CQMKHDGCHNTDAFDWSGQNLAWMGYYNPLNVTHYLEWG-----VDMWYDEAVYTKQAYIDAYPS 166

  Fly   141 ---SPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNK--LYVCNYGPGGNVVGYNPYEVGKPSCS- 199
               .|..||::.||....:.|||..|.|..:.:..|  |..|||. ..||:|...|.    ||| 
  Fly   167 NYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYA-ATNVLGIKMYS----SCSK 226

  Fly   200 -----TYGMKPSSRYQGLCAAPGSSPAANSVY 226
                 |.|..|  :|:.||:|.......|..|
  Fly   227 AASKCTTGTNP--KYKYLCSAKEEYNVNNLFY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 45/156 (29%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 45/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455051
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.