DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and crispld1b

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_009296842.1 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:337 Identity:92/337 - (27%)
Similarity:134/337 - (39%) Gaps:105/337 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLTTIM-IISCEVAFACNGKIIAS------------------GITAEERSIILQEHNRLRQIVA 52
            |||.|:. ::|..:..|.:.:.|..                  .|:..:..:||..||:||    
Zfish    14 VLLVTVQTVVSMVIPNATHLEAILEKYMDKDETWWQSKSRGKRAISQSDMQLILDLHNKLR---- 74

  Fly    53 TGRYPGQ--PGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDA 115
                 ||  |.|.||..:|||.||...|:.||..|.:.|.|...:.|  :||||...|..     
Zfish    75 -----GQVYPPASNMEYMVWDTELERSAEHWAHTCLWEHGPSHLLTR--IGQNLGAHWGR----- 127

  Fly   116 DDGDFPS--RIQSWFNEVQKYSFG-----------DAWSPKTGHYSQLVWGETSLVGCGYAEYKD 167
               |.|.  .:|:|::||:.:|:.           ....|...||:||||..::.:||......:
Zfish   128 ---DRPPTFHVQAWYDEVRDFSYPYPQECNPHCPYRCSGPVCTHYTQLVWATSNKIGCAINVCYN 189

  Fly   168 TSKYNKLY------VCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLCAAPGSSPAANSVY 226
            .:.:..::      ||||.|.||..|:.||:.|.| ||  ...||  |.|.|       ..|..|
Zfish   190 MNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKHGTP-CS--ACPPS--YGGGC-------RNNLCY 242

  Fly   227 ---GANTIETYEYGYNSSPSSQTANNNPPTNNINKSQFSYNQPRPKPV---------QTINPNPS 279
               |:|    |.|      :.:|..||            |.:|.|:||         :|..|:|:
Zfish   243 KDDGSN----YHY------TPETEENN------------YIEPEPEPVRSHDTHYRDETTTPSPN 285

  Fly   280 PFNPQAAVPSAS 291
            ....:..|.|.|
Zfish   286 ENIERNEVSSTS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 48/163 (29%)
crispld1bXP_009296842.1 SCP_euk 64..208 CDD:240180 48/162 (30%)
LCCL 301..385 CDD:128866
LCCL 404..501 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585648
Domainoid 1 1.000 81 1.000 Domainoid score I8420
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25860
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.