DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG34002

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:254 Identity:61/254 - (24%)
Similarity:98/254 - (38%) Gaps:56/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFR-----------HD 90
            :.:||..||..|.|||.|:....|.|..|.::.||.|||..|......|..:           ..
  Fly    69 KKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSS 133

  Fly    91 P--HRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNE---VQKYSFGDAWS---PKTGHY 147
            |  |...|:|...::...|            ..|::.:|:::   |...|..|..|   .:.||:
  Fly   134 PSYHAVYNKFKAKEDTFRI------------VRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHF 186

  Fly   148 SQLVWGETSLVGCGYAEYKDTSKYNKLYVCNY--GPGGNVVGYNPYEVGKPS--CSTYGMKPSSR 208
            .:::.|.::.:||..|..:.....::...|.|  .|..|.:.|. |. |||.  |:| |:  :.:
  Fly   187 LRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSLLYE-YS-GKPGVYCTT-GI--NGK 246

  Fly   209 YQGLCAAPGSSPAANSVYGANTIETYEYGYNSSPSSQTANNNPPTNNINKSQFSYNQPR 267
            :|.||  ..:.|..:.::              |...||...|..|:.|........|||
  Fly   247 FQNLC--NDTEPVKDCMH--------------SELFQTITANDTTSLIRSMLNRQTQPR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 38/163 (23%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 37/161 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466836
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.