DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG3640

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:92/224 - (41%) Gaps:26/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFT-M 100
            ::.|:.:.|..|..||:|.......|..|..:.||.|||..|:..|..|....|..|...||. :
  Fly    65 QAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHV 129

  Fly   101 GQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFG-DAWSPKT--GHYSQLVWGETSLVGCGY 162
            ||....:..:|...:|......:|.:||.:..:.|.. .|..|.:  ..:.||:...::.:|||.
  Fly   130 GQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGV 194

  Fly   163 AEYKDTSKYNKLY-VCNYGPGGNVVGYNPYEVG--KPSCSTYGMKPSSRYQGLCAAPGSSPAANS 224
            ...:....:::.: |||:. ..|:.....|:||  ...|.: |..|  ||..||       |...
  Fly   195 LRQRSHMLWHQQFIVCNFA-RRNMPREQVYQVGVAATGCRS-GRNP--RYPNLC-------ALQE 248

  Fly   225 VYGANTIETY--------EYGYNSSPSSQ 245
            .|..|.::.:        .:.|::|..|:
  Fly   249 EYDVNAVDRFHSKRPLRIRFKYSASHPSK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 38/147 (26%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 38/147 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455049
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.