DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG17974

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:215 Identity:60/215 - (27%)
Similarity:88/215 - (40%) Gaps:35/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDP-HRTINR 97
            :..::..|..||:.|..:|.|:.||...|..|..:||||||...:......|:..||. |.|...
  Fly    60 SRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRY 124

  Fly    98 FTMGQNLAIIWSTAPLDADDGDFPSRIQS----WFNEVQ--KYSFGDAWS-----PKTGHYSQLV 151
            ...||||..:|...   :...:..|.::.    ||||..  ..||.|::.     ...||:::|.
  Fly   125 ANSGQNLCAVWRPR---SPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELS 186

  Fly   152 WGETSLVGCGY-----AEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPS--CSTYGMKPSSRY 209
            ..:...|||..     .:|.....||  ::|||. ....:|...||.|:.:  |:|   ..|..|
  Fly   187 VDKNFAVGCSIMRFTRPDYPSVYIYN--FICNYA-SLYALGAPVYETGRAASRCTT---GKSHFY 245

  Fly   210 QGLCAAPGSSPAANSVYGAN 229
            .|||       :...||..|
  Fly   246 PGLC-------STREVYDPN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 45/159 (28%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455046
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.