DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG9822

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster


Alignment Length:238 Identity:66/238 - (27%)
Similarity:92/238 - (38%) Gaps:65/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VAFACN--GKIIAS---GITAEE----RSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDEL 74
            |..|||  ||...|   ..|..:    |.:|:.|||:.|..:|:|..||...|..|..:|||:||
  Fly    37 VHIACNNDGKFHESCSPDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEEL 101

  Fly    75 AARAQKWADNCQFRHDPHRTINRF-TMGQNLAII-----WSTAPLDADDGDFPSRIQS----WFN 129
            ...|......|...||......|| .:||||..:     |        |.:..:.::.    ||.
  Fly   102 EYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVDRRRNW--------DLNVTNLVEQSMGLWFG 158

  Fly   130 E-----------------VQKYSFGDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYV- 176
            |                 ::||          ||:.:.|....:.|||....:.: .:|..||: 
  Fly   159 EHKLIDSSYITDFKLTKDLEKY----------GHFVETVLDRNTHVGCAMMRFTN-PQYPFLYIY 212

  Fly   177 ---CNYGPGGNVVGYNPYEVGKPS--CSTYGMKPSSRYQGLCA 214
               |||. ....:|...|..|||:  |.| |..|  .|..||:
  Fly   213 NTACNYA-SVYAIGVPVYNAGKPASECRT-GSNP--EYPALCS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 45/173 (26%)
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 45/173 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.