DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:197 Identity:59/197 - (29%)
Similarity:86/197 - (43%) Gaps:44/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIASGITA----EERSIILQE----HNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWAD 83
            :::||:.|    ||....:.|    ||.||..|    :|  ||. |:|.:.||..|:..|:.|..
  Rat    35 LMSSGLNAKLPLEEDVDFINEYVNLHNELRGTV----FP--PGV-NLRFMTWDVALSRTARAWGK 92

  Fly    84 NCQFR--------HDPHRTINRFT-MGQNLAIIWSTAPLDADDGDF--PSRIQSWFNEVQKYSF- 136
            .|.|.        |:.|..   || :|:|:.:        ..:.||  .:.|:||..|.:.|:: 
  Rat    93 KCVFERNTHLDKVHESHPV---FTDIGENMWV--------GPEKDFTATNAIRSWHEERKSYNYV 146

  Fly   137 GDAW--SPKTGHYSQLVWGETSLVGCGYAEYKDTS--KYNKLYVCNYGPGGNVVGYNPYEVGKPS 197
            .|..  .....||.||||..:..|||.........  .|..|::|||.|||.:. ..||:.|: .
  Rat   147 NDTCIEDEDCSHYIQLVWDHSYKVGCAVTPCAKVGAITYAALFICNYAPGGTLT-RRPYQAGQ-F 209

  Fly   198 CS 199
            ||
  Rat   210 CS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 45/162 (28%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 47/163 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344590
Domainoid 1 1.000 82 1.000 Domainoid score I8206
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45097
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.