DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and R3hdml

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:202 Identity:64/202 - (31%)
Similarity:94/202 - (46%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            |:|.:.:.:|..||.:|..|       .|.|.||..:|||::||..|:.||..|.:.|.|.: :.
  Rat    58 ISARDMNALLDYHNHIRASV-------HPPASNMEYMVWDEQLARAAEAWATQCIWAHGPSQ-LT 114

  Fly    97 RFTMGQNLAIIWSTAPLDADDGDFPS---RIQSWFNEVQKYSFGD--------AW---SPKTGHY 147
            :: :||||::         ..|.:.|   .::||..|.:.|||..        .|   .|...||
  Rat   115 KY-VGQNLSV---------HSGRYRSVVDLVKSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHY 169

  Fly   148 SQLVWGETSLVGCGYAEYKDTSKYNKLY------VCNYGPGGNVVGYNPYEVGKPSCSTYGMKPS 206
            :|:||..:|.:||........:.:...:      ||||...||.:|..||:.||| ||  ...||
  Rat   170 TQMVWASSSRLGCAIHTCSSINVWGSTWQQAVYLVCNYAIKGNWIGEAPYKTGKP-CS--ACPPS 231

  Fly   207 SRYQGLC 213
              |||.|
  Rat   232 --YQGNC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 45/162 (28%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 44/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344576
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.