DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Crisp2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:182 Identity:67/182 - (36%)
Similarity:91/182 - (50%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHD--PHRTINRFTMGQ 102
            |:.:||.||:.|:       |...|:.::.|:.:.||.|||||:||...|.  ..|.|| ...|:
  Rat    41 IIAKHNELRRQVS-------PPGSNILKMEWNVQAAANAQKWANNCILEHSSTEDRKIN-IKCGE 97

  Fly   103 NLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPKT--GHYSQLVWGETSLVGCG--YA 163
            ||.       :..|...:.:.||||:.|.:.:.||....|.:  |||:||||..:..||||  |.
  Rat    98 NLY-------MSTDPTSWRTVIQSWYEENENFVFGVGAKPNSAVGHYTQLVWYSSFKVGCGVAYC 155

  Fly   164 EYKDTSKYNKLYVCNYGPGGNVV--GYNPYEVGKPSCSTYGMKPSSRYQGLC 213
            ..:||.||  .|||:|.|.||.|  ...||..|.|..|.    |::...|||
  Rat   156 PNQDTLKY--FYVCHYCPMGNNVMKKSTPYHQGTPCASC----PNNCDNGLC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 53/145 (37%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 54/147 (37%)
Crisp 189..243 CDD:400739 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344586
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.