Sequence 1: | NP_650264.1 | Gene: | CG8483 / 41623 | FlyBaseID: | FBgn0038126 | Length: | 392 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030099497.1 | Gene: | Clec18a / 353287 | MGIID: | 2672935 | Length: | 615 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 60/198 - (30%) |
---|---|---|---|
Similarity: | 86/198 - (43%) | Gaps: | 24/198 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
Fly 97 RFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD---AWSPKTGHYSQLVWGETSLV 158
Fly 159 GCGYAEYKDTSKYNKLYVCNYGPGGN--VVGYN--PYEVGKPSCSTYGMKPSSRYQ------GLC 213
Fly 214 AAP 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8483 | NP_650264.1 | SCP_euk | 37..180 | CDD:240180 | 43/145 (30%) |
Clec18a | XP_030099497.1 | CAP_euk | 129..263 | CDD:349399 | 43/143 (30%) |
EGF_Lam | 315..360 | CDD:214543 | |||
CLECT | 390..514 | CDD:153057 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167841141 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X7576 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.850 |