DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Clec18a

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_030099497.1 Gene:Clec18a / 353287 MGIID:2672935 Length:615 Species:Mus musculus


Alignment Length:198 Identity:60/198 - (30%)
Similarity:86/198 - (43%) Gaps:24/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            ::.:|..:||..|||||..|       .|.|.||:.:.|.:.||..|:..|..|.....|:..  
Mouse   122 LSRKESFLILTAHNRLRSRV-------HPPAANMQRMDWSESLAQLAEARAALCVTSVTPNLA-- 177

  Fly    97 RFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD---AWSPKTGHYSQLVWGETSLV 158
             .|.|.|..:.|:...:......|...:..||.|..:|..||   |.:....||:||||..:|.:
Mouse   178 -STPGHNSHVGWNVQLMPMGSASFVEVVNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSSQL 241

  Fly   159 GCGYAEYKDTSKYNKLYVCNYGPGGN--VVGYN--PYEVGKPSCSTYGMKPSSRYQ------GLC 213
            |||........:..:.:||.|.||||  :.|..  ||:.| ..||....:.|..::      |||
Mouse   242 GCGRQPCFVDQEAMEAFVCAYSPGGNWDINGKTVAPYKKG-TWCSLCTARVSGCFKAWDHAGGLC 305

  Fly   214 AAP 216
            ..|
Mouse   306 EVP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 43/145 (30%)
Clec18aXP_030099497.1 CAP_euk 129..263 CDD:349399 43/143 (30%)
EGF_Lam 315..360 CDD:214543
CLECT 390..514 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7576
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.