DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG16995

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster


Alignment Length:155 Identity:42/155 - (27%)
Similarity:75/155 - (48%) Gaps:35/155 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHD-PHRTINRFTMGQN 103
            :||.||..|     .::..||       :....:|...|.:||:....|:. .||..:.:  |:|
  Fly    10 VLQAHNLYR-----AKHGAQP-------LTLSPKLNRLATEWANYLLSRNRMEHRQNSGY--GEN 60

  Fly   104 LAIIWSTAPLDADDGDF--PSRIQSWFNEVQKYSFGD-AWSPKTGHYSQLVWGETSLVGCGYAEY 165
            :.:        |..|:.  ...::||:.|:::|::.. ::...|||::|:||..::.:|.|:|:.
  Fly    61 IYM--------ASGGNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAKS 117

  Fly   166 KDTSKYNKLY-VCNYGPGGNVVGYN 189
            ..|     :| ||||.|.||   ||
  Fly   118 GST-----IYVVCNYNPPGN---YN 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 36/144 (25%)
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 33/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.