DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG4270

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:112 Identity:38/112 - (33%)
Similarity:61/112 - (54%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AQKWADNCQFRHD-PHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDA-W 140
            ||:||::.:.::. .||...::  |:|   |:.:..:|. .||.|  ::.|:.|:..|.|..| :
  Fly    61 AQEWANHLRDQNTMAHRPNPKY--GEN---IFLSGGMDV-TGDLP--VEMWYREINSYDFNKAQF 117

  Fly   141 SPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVG 187
            .|..||::||:|..:..:|.|.|...|.:    ..||||.|.|||||
  Fly   118 VPTAGHFTQLIWKSSVEMGSGVARKADRT----WVVCNYNPPGNVVG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 31/103 (30%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 34/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455028
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.