DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG31296

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:239 Identity:50/239 - (20%)
Similarity:82/239 - (34%) Gaps:61/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RSIILQEHNRLRQIVATGRYPG-QPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTM 100
            |:::|...|..|...|:|:... :..|..|..:.:..||...|:.....|........:...:.:
  Fly    61 RNLLLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCSTHKFCLNSQEFYYV 125

  Fly   101 GQNLAIIWSTAPL----DADDGDFPSR-IQSWFNEVQKYSFGDAWSPKTGHYSQLVWGETSL--- 157
            |.|   |.||..|    |.:|.:...| ||.|..      :.|..:.|.|.|.....|::.:   
  Fly   126 GTN---IGSTHYLGNLNDYEDLELMLRIIQHWTR------YADYVNIKMGVYMPTTLGKSGIAKA 181

  Fly   158 ----------VGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNP-YEVG-KPSCSTYGMKPSSRYQ 210
                      |||....:...|.:|.:::|.:..  ::....| |.:. :|..:...:.|:  |.
  Fly   182 LLLMADRNTHVGCSAMRFTVHSVHNFVFLCAFST--DLFVERPIYRMSMRPGAACKRLDPT--YS 242

  Fly   211 GLCAAPGSSPAANSVYGANTIETYEYGYNSSPSSQTANNNPPTN 254
            .|||..               |.||            ||.|..|
  Fly   243 ALCAVG---------------ENYE------------NNKPMLN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 35/161 (22%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 35/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.