DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG31286

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:183 Identity:41/183 - (22%)
Similarity:76/183 - (41%) Gaps:33/183 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAVLLTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIV 69
            |.|::..:.|...:..||.|         .:...|:|:|.|:.|.     |: |.|      ::.
  Fly     6 SLVIVFLVAISEFDRNFAIN---------HDNAGIVLREINKRRD-----RH-GVP------KLT 49

  Fly    70 WDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKY 134
            .|:.|:...|.:|    ::.....|:| ::...|.....|....:...|.....:::|:|. :|:
  Fly    50 LDNVLSKGCQSYA----WKLSKSATLN-YSDPTNKDYTESICRFEVKRGALSRCVKNWYNG-RKF 108

  Fly   135 SFGDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVG 187
               |...||...::.::|  .|.|..||.: .:.:....::|..|.|.|||.|
  Fly   109 ---DILDPKAKDFTAMIW--RSSVSLGYGD-ANINALQGVFVVRYTPPGNVKG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 29/142 (20%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455032
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.