DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG32313

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster


Alignment Length:184 Identity:47/184 - (25%)
Similarity:81/184 - (44%) Gaps:45/184 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAA 76
            :.:|:.||   || :.|..|:    ||:||:.|||.|     .:|..||       :|.|:||..
  Fly     7 LFLIAIEV---CN-QTIGIGL----RSLILEAHNRRR-----AKYGNQP-------MVLDEELCT 51

  Fly    77 RAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADD--------GDFPSR-IQSWFNEVQ 132
            ...::||.. .|::...|.|      .|..:::|.|:.|..        ...|.. ::.||:   
  Fly    52 ECSEYADEI-VRNEGVYTEN------YLEYLYATDPISAKHLQVVCVFREALPRECVRIWFH--- 106

  Fly   133 KYSFGDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVV 186
             |. |.|.:.|...::.::|..::.:|.|....::|    :..|..|.|.||::
  Fly   107 -YR-GFAENTKYYRFTAMIWNASTRLGVGLGRIQET----RYLVVRYAPPGNIL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 36/151 (24%)
CG32313NP_001261262.1 SCP 27..153 CDD:294090 37/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455033
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.