DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Clec18a

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:202 Identity:61/202 - (30%)
Similarity:85/202 - (42%) Gaps:24/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPH 92
            |...::.:|..:||..|||||..|       .|.|.||:.:.|.:.||..||..|..|.....|:
  Rat    66 IVQALSRKESFLILTTHNRLRSQV-------HPSAANMQRMDWSESLAQLAQARAALCGTSATPN 123

  Fly    93 RTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD---AWSPKTGHYSQLVWGE 154
            ...   |:.....:.|:...|......|...:..||.|..:|..|.   |.:....||:||||..
  Rat   124 LAA---TLRNTPDVGWNVQLLPMGSASFVEVVNVWFAEGLQYRHGSAECAHNATCAHYTQLVWAT 185

  Fly   155 TSLVGCGYAEYKDTSKYNKLYVCNYGPGGN--VVG--YNPYEVGKPSCSTYGMKPSSRYQ----- 210
            :|.:|||:..........:.:||.|.||||  :.|  ..||:.| |.||......|..::     
  Rat   186 SSQLGCGWQPCFVDQVATEAFVCAYSPGGNWEINGKMIAPYKKG-PWCSLCTASVSGCFKAWDHA 249

  Fly   211 -GLCAAP 216
             |||..|
  Rat   250 GGLCEVP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 42/145 (29%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 42/143 (29%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7576
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.