DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Pi15

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:269 Identity:76/269 - (28%)
Similarity:117/269 - (43%) Gaps:59/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQPSAVLLTTIMIISCEVAF------------ACNGKIIASGITAEERSIILQEHNRLRQI--- 50
            |:..|||.|..::.:.||...            |.|...|.:.::....|:.:.:..|.|.|   
  Rat     1 MVMISAVNLVILLSLLCEARTIVLLNFTDSSLPANNFSDIEATLSVPVLSVDIPKARRKRYISQN 65

  Fly    51 --VATGRYPGQ------PGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAII 107
              :|...|..|      |.|.||..:|||:.||..|:.||..|.:.|.|...: || :||||:: 
  Rat    66 DMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLL-RF-LGQNLSV- 127

  Fly   108 WSTAPLDADDGDFPSRIQ---SWFNEVQKYSFG-----------DAWSPKTGHYSQLVWGETSLV 158
                    ..|.:.|.:|   .|::||:.|:|.           ..:.|...||:|:||..::.:
  Rat   128 --------RTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRI 184

  Fly   159 GCGYAEYKDTSKYNKLY------VCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLCAAPG 217
            ||.....::.:.:..::      ||||.|.||.:|..||:||.| ||:  ..||  |.|.|....
  Rat   185 GCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVP-CSS--CPPS--YGGACTDNL 244

  Fly   218 SSPAANSVY 226
            ..|...:.|
  Rat   245 CFPGVTTNY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 47/173 (27%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 43/153 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344578
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45097
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.