DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CLEC18C

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_775890.2 Gene:CLEC18C / 283971 HGNCID:28538 Length:446 Species:Homo sapiens


Alignment Length:202 Identity:64/202 - (31%)
Similarity:89/202 - (44%) Gaps:25/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPH 92
            :|..:..:|..::|..|||||..|       ||.|.:||.:.|.|.||..||..|..|..   |.
Human    39 MAGALNRKESFLLLSLHNRLRSWV-------QPPAADMRRLDWSDSLAQLAQARAALCGI---PT 93

  Fly    93 RTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF--GD-AWSPKTGHYSQLVWGE 154
            .:: ...:.:.|.:.|:...|.|....|...:..||.|.|:||.  |: |.:....||:||||..
Human    94 PSL-ASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWAT 157

  Fly   155 TSLVGCGYAEYKDTSKYNKLYVCNYGPGGN--VVGYN--PYEVGKPSCSTYGMKPSSRYQ----- 210
            :|.:|||...........:.:||.|.|.||  |.|..  ||:.| ..||......|..::     
Human   158 SSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKG-AWCSLCTASVSGCFKAWDHA 221

  Fly   211 -GLCAAP 216
             |||..|
Human   222 GGLCEVP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 46/145 (32%)
CLEC18CNP_775890.2 SCP_euk 50..183 CDD:240180 46/143 (32%)
CLECT 310..434 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151029
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7576
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.