DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Crisp2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:187 Identity:63/187 - (33%)
Similarity:88/187 - (47%) Gaps:39/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHD--PHRTINRFTMGQ 102
            |:.:||.||:.|       .|...::.::.|..:....|||||:.|...|.  ..|.|| ...|:
Mouse    41 IVNKHNELRRSV-------NPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKIN-IRCGE 97

  Fly   103 NLAI-----IWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPKT--GHYSQLVWGETSLVGC 160
            ||.:     :|||.            ||||:||.:.:.:|....|.:  |||:||||..:..:||
Mouse    98 NLYMSTDPTLWSTV------------IQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGC 150

  Fly   161 G--YAEYKDTSKYNKLYVCNYGPGGNVV--GYNPYEVGKPSCSTYGMKPSSRYQGLC 213
            |  |...:|..||  .|||:|.|.||.|  ...||:.|.|..|.    |::...|||
Mouse   151 GIAYCPNQDNLKY--FYVCHYCPMGNNVMKKSTPYQQGTPCASC----PNNCENGLC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 49/150 (33%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 50/151 (33%)
Crisp 189..243 CDD:285731 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841178
Domainoid 1 1.000 72 1.000 Domainoid score I9265
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5341
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.