DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and scl-19

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_507654.2 Gene:scl-19 / 191308 WormBaseID:WBGene00013971 Length:207 Species:Caenorhabditis elegans


Alignment Length:228 Identity:59/228 - (25%)
Similarity:91/228 - (39%) Gaps:45/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPG----QPGAENMRE 67
            :||..::.||     :.:|::..:|     |..:|..||:||..||.|.:..    :|.|.||..
 Worm     3 LLLFLLLAIS-----SSSGQLSPNG-----RQQVLDFHNKLRSQVALGVFSANGTIKPPARNMER 57

  Fly    68 IVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLD----ADDGDFPSRIQSWF 128
            :.:..:....||.:..:|     |...  ...:|:|:.:.:.|..:|    :.|......:..|.
 Worm    58 LTYGQQFERLAQDYVADC-----PDGL--EIPIGRNIGMNYYTTKVDETYNSMDEYVIDALNDWA 115

  Fly   129 NEVQKYSFGDAW------SPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVG 187
            .|.|.    :.|      .......||:||..|..||||   .|.....|.:.||.|...||:||
 Worm   116 EEFQV----NGWLSTIYNDTSISAASQMVWAGTKYVGCG---VKRCDPINVVVVCMYYQQGNLVG 173

  Fly   188 YNPYEVGKP--SCSTYGMKPS-----SRYQGLC 213
            ...|:.|.|  :|....:.|.     .|..|||
 Worm   174 RPIYKEGPPCTACPPMRICPGQKECCDRVMGLC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 39/156 (25%)
scl-19NP_507654.2 SCP 21..167 CDD:214553 41/164 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161832
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.