DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and scl-27

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_503189.2 Gene:scl-27 / 191204 WormBaseID:WBGene00022638 Length:200 Species:Caenorhabditis elegans


Alignment Length:221 Identity:48/221 - (21%)
Similarity:87/221 - (39%) Gaps:38/221 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQ---PGAENMREIVW 70
            :.|.:|:...:|     |:.|.....|....|::.||.|...||.|:|...   |.|..|..:.|
 Worm     1 MNTALILLALIA-----KLAADLYGKEAYDRIVKVHNELGNDVACGKYQNHSDYPKASQMMMMKW 60

  Fly    71 DDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYS 135
            :..||........:||...:  |.:.:|..|:||..::           |.:.:.....|..:..
 Worm    61 NQSLAEAVGNVKHSCQQLKE--RYLKKFIKGENLYRVY-----------FYNTVVDGLQERDEIL 112

  Fly   136 FGDAWSPKTG------HYSQLVWGETSLVGCGYAEYKDTSKYN-KLYVCNYGPGGNVVGYNPYEV 193
            .....:..||      .:.:::..:.:.:||.|...::...|: :.::|.|.|..|   .:.|.|
 Worm   113 RRSEKAVSTGANFEVERFHKILHDKVTSIGCSYKNCENDQGYDMRYFICKYSPIDN---GDMYHV 174

  Fly   194 GKPSCS------TYGMKPSSRYQGLC 213
            |:| ||      :.....:|.:..||
 Worm   175 GEP-CSQCPVGTSCNQNANSEFFNLC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 30/152 (20%)
scl-27NP_503189.2 CAP_euk 27..164 CDD:349399 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.