DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and F58E2.5

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_500349.1 Gene:F58E2.5 / 186521 WormBaseID:WBGene00019049 Length:232 Species:Caenorhabditis elegans


Alignment Length:254 Identity:58/254 - (22%)
Similarity:94/254 - (37%) Gaps:83/254 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRY-----------PGQP 60
            :||..:::::|......|   :||.|..::   ||..:|.||..:|.|.:           |..|
 Worm    16 LLLPYLLLMNCITFLFLN---LASAIAHKD---ILNAYNNLRSEIANGTFTMKLQFPDITIPLAP 74

  Fly    61 GAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQ 125
            .| .|.::.|:..|||.||.:.|:|....|......:|.:..:.        |||:       :|
 Worm    75 AA-GMLKLKWNCRLAALAQAYVDSCPSYQDLRVHKPKFPVTYSF--------LDAN-------LQ 123

  Fly   126 SWFNEVQKYSF------------GDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCN 178
            ....:...|.|            .|.|      :.:|:  .:..:||.:    :....|.|:||.
 Worm   124 EHIKDPVLYRFKILEMDFRRGYINDDW------FKKLI--SSKSIGCAF----NNCSENVLFVCY 176

  Fly   179 YGP-----------GGNVVG--------YNP-YEVGKPSCSTYGMKPSSRYQG---LCA 214
            |..           ||...|        |.| |:.|| :||  ...|.:..:|   ||:
 Worm   177 YKEQIYEDFKFPVNGGAEPGRFIKELDDYVPRYKEGK-ACS--ACPPPTSCRGSSVLCS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 36/165 (22%)
F58E2.5NP_500349.1 CAP_euk 40..177 CDD:349399 36/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.