DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and F57B7.2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:170 Identity:53/170 - (31%)
Similarity:69/170 - (40%) Gaps:27/170 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTI--NRFTMGQN 103
            |..||..||     ||    |.||   :.|..|||..|..||....   |..|.:  ....:|:|
 Worm   159 LDAHNECRQ-----RY----GNEN---LCWSTELAEMAHAWAVKLA---DRGRVLYPELPGIGEN 208

  Fly   104 LAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFG-DAWSPKTGHYSQLVWGETSLVGCGYAEYKD 167
            |.:..:........|.  ..||.|..|.|.:.|. ..|:||...:||:||.:|:.:|.  |.|.:
 Worm   209 LILKEANEQSHLPTGQ--EVIQEWEKEAQFFDFDKPRWNPKCQRFSQVVWKDTTELGA--ARYWN 269

  Fly   168 TSKYNKLYVCNYGPGGNVVGYNPYEVGKPS--CSTYGMKP 205
            |:......||.|.|.||......:....||  ||   |.|
 Worm   270 TANNCVAVVCFYRPAGNSNAPGEFASNVPSRDCS---MSP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 43/141 (30%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 45/145 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.