DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and scl-14

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_502532.1 Gene:scl-14 / 184246 WormBaseID:WBGene00008625 Length:208 Species:Caenorhabditis elegans


Alignment Length:235 Identity:66/235 - (28%)
Similarity:96/235 - (40%) Gaps:49/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPG----QPGAENMRE 67
            :||.|::.......|..||           ::.||..||.||..:|.|.|..    :..|.:|.:
 Worm     5 ILLLTVLCAGAYTQFTANG-----------QAAILNVHNTLRSRIAKGTYVARGTVKHAASDMLK 58

  Fly    68 IVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQ 132
            :.|...||..:|.:|:.|...|.     |...:|:||...|::..:...|........:|..|.|
 Worm    59 MKWLRSLATSSQIYANRCPTGHS-----NMIGVGENLYWYWTSGTITNIDQFGAMASAAWEKEFQ 118

  Fly   133 KYSFGDAWSPKT----------GHYSQLVWGETSLVGCGYAEY-KDTSKYNKL-YVCNYGPGGNV 185
            .|    .||..|          ||.:|:.|.:|:|:|||.... .||:..||: .||:|.|.||.
 Worm   119 DY----GWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNY 179

  Fly   186 VGYNPYEVGKPSCSTYGMKPSSRYQGLCAAPGSSPAANSV 225
            :..|.|..| .:||.            |.|..|..||..:
 Worm   180 LNQNIYTSG-TTCSK------------CPAGTSCEAATGL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 46/158 (29%)
scl-14NP_502532.1 SCP 22..175 CDD:214553 49/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.