DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and scl-15

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_494496.1 Gene:scl-15 / 184099 WormBaseID:WBGene00017183 Length:207 Species:Caenorhabditis elegans


Alignment Length:222 Identity:67/222 - (30%)
Similarity:99/222 - (44%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPG-----QPGAENMR 66
            :||..:..:|....|:..|           :..|:..||.||..:|.|.|..     :||: |:.
 Worm     5 ILLAVVASVSVYGQFSKAG-----------QKAIVDAHNTLRSSIAKGTYVANKTRKEPGS-NIL 57

  Fly    67 EIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQ-SWFNE 130
            ::.||..:|..||.:|:.|...|      .:...|:||...||.|.:.:.| |:..|.. :|.:|
 Worm    58 KMKWDPTIAKSAQAYANTCPTGH------GKSKYGENLYWRWSGAVIKSID-DYGVRASGAWASE 115

  Fly   131 VQKYSFG----DAWSPKT--GHYSQLVWGETSLVGCGYAEY-KDTSK-YNKLYVCNYGPGGNVVG 187
            .|||.:.    |:...||  ||.:|:.|..|..:|||.... .|.:| |....||.|...||::.
 Worm   116 FQKYGWKTNKLDSALFKTGIGHATQMAWASTGSIGCGVKNCGMDKNKMYKVAVVCQYSARGNMIN 180

  Fly   188 YNPYEVGKPSCSTYGMKPS-SRYQGLC 213
            .|.|..|| :||....|.. .:..|||
 Worm   181 NNIYTAGK-TCSACPAKTKCEKATGLC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 49/156 (31%)
scl-15NP_494496.1 SCP 22..173 CDD:214553 50/169 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161831
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.