DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and scl-13

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_504055.1 Gene:scl-13 / 178798 WormBaseID:WBGene00019179 Length:208 Species:Caenorhabditis elegans


Alignment Length:214 Identity:72/214 - (33%)
Similarity:108/214 - (50%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CEVA-FACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPG----QPGAENMREIVWDDELAA 76
            |.:| |.|.....:|  ||:.:  |:..||:||..:|.|.|..    :|.|.|||:||||:.:||
 Worm     6 CLLAIFGCATAQFSS--TAQGQ--IVDAHNKLRSAIAQGSYVAAGTQEPSASNMRKIVWDETVAA 66

  Fly    77 RAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWS 141
            .||::|:.|.   |.|   :..:.|:||...||::...:.|....:...||.:|.|||.:...:.
 Worm    67 AAQEYAEGCP---DDH---SGTSYGENLYWSWSSSAPSSLDKFGVAASNSWESEFQKYGWTSTFL 125

  Fly   142 PKT------GHYSQLVWGETSLVGCGYAEY-KDTSK---YNKLYVCNYGPGGNVVGYNPYEVGKP 196
            .:.      ||.:|:.|.|||.:|||.... ||.:|   |....||.|...||::..:.|:.|: 
 Worm   126 DEAGFATGIGHATQMAWAETSKIGCGIKNCGKDANKKNMYKVAVVCQYDSAGNMMDSDIYQQGE- 189

  Fly   197 SCSTYGMKPS-SRYQGLCA 214
            :||......| .:..||||
 Worm   190 TCSACSEDASCEQDSGLCA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 53/156 (34%)
scl-13NP_504055.1 SCP 21..174 CDD:214553 55/160 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.