DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CRISP1

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:194 Identity:56/194 - (28%)
Similarity:81/194 - (41%) Gaps:44/194 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQ---KWADNCQFRHDPHRTINRFTMG 101
            |:..||.||:.|.       |.|.||.::.|.:|.|..|:   |:.|..:......|..|.| .|
Human    44 IVNIHNALRRRVV-------PPASNMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTF-CG 100

  Fly   102 QNL-----AIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSP-----KTGHYSQLVWGETS 156
            :|:     .:.||            |.|..|::|...:..|: |:.     .|.||:|:||..:.
Human   101 ENMHMTSYPVSWS------------SVIGVWYSESTSFKHGE-WTTTDDDITTDHYTQIVWATSY 152

  Fly   157 LVGCGYAEYKDTSKYNKLYVCNYGPGGN--VVGYNPYEVGKP--SCSTYGMKPSSRYQGLCAAP 216
            |:||..|..:.......||||:|...||  .....||:.|.|  :|      ||:....||..|
Human   153 LIGCAIASCRQQGSPRYLYVCHYCHEGNDPETKNEPYKTGVPCEAC------PSNCEDKLCTNP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 43/152 (28%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 44/153 (29%)
Crisp 195..249 CDD:285731 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151110
Domainoid 1 1.000 88 1.000 Domainoid score I7923
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.