DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and GLIPR2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 / 152007 HGNCID:18007 Length:169 Species:Homo sapiens


Alignment Length:154 Identity:43/154 - (27%)
Similarity:68/154 - (44%) Gaps:21/154 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNL 104
            :|:.||..||      ..|.|..:..:.:  :.|....::..|.....:|.|..  :|...|:||
Human    28 VLKAHNEYRQ------KHGVPPLKLCKNL--NREAQQYSEALASTRILKHSPES--SRGQCGENL 82

  Fly   105 AIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD-AWSPKTGHYSQLVWGETSLVGCGYAEYKDT 168
            |  |  |..|....:...|   |::|::.|:|.. .::..|||::.:||..|..:|.|.|...|.
Human    83 A--W--ASYDQTGKEVADR---WYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDG 140

  Fly   169 SKYNKLYVCNYGPGGNVVGYNPYE 192
            |.:   .|..|.|.||||....:|
Human   141 SSF---VVARYFPAGNVVNEGFFE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 36/140 (26%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 39/145 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.