DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG43777

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:200 Identity:54/200 - (27%)
Similarity:80/200 - (40%) Gaps:21/200 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RSIILQEHNRLRQIVATG--RYPGQ---PGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            :.|.|...|.||...|.|  |..|.   ..|..||::.||.|||......|.....:....|:..
  Fly    64 QKIALDILNNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQCRSTL 128

  Fly    97 RFT-MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD----AWSP----KTGHYSQLVW 152
            ||. :|:.:|::.....|:..: .:.......|.|.|..|..|    |:.|    :..|::.::.
  Fly   129 RFPHVGEAIALVTPREKLNLKE-IYSKAFTPMFAEYQHVSDPDALLHAFDPDRDFQVRHFTNIIS 192

  Fly   153 GETSLVGCGY---AEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKP--SCSTYGMKPSSRYQGL 212
            ...|.||||.   |....:.|:.....| |....|:.|...|:.|.|  ||..:|:..|.:|..|
  Fly   193 DRVSRVGCGVAVGANCNPSIKFCHFLTC-YFDFHNMAGSYVYKAGDPTSSCDDWGVVSSDKYANL 256

  Fly   213 CAAPG 217
            |...|
  Fly   257 CKNSG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 40/159 (25%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 41/160 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.