powered by:
Protein Alignment CG8483 and T12A7.10
DIOPT Version :9
Sequence 1: | NP_650264.1 |
Gene: | CG8483 / 41623 |
FlyBaseID: | FBgn0038126 |
Length: | 392 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255586.1 |
Gene: | T12A7.10 / 13198309 |
WormBaseID: | WBGene00194933 |
Length: | 86 |
Species: | Caenorhabditis elegans |
Alignment Length: | 49 |
Identity: | 14/49 - (28%) |
Similarity: | 19/49 - (38%) |
Gaps: | 4/49 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 IMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQP 60
|.::|..|.|..||..:...:| ........||...:..| |.|.||
Worm 4 IFLLSVFVIFNVNGCQVGPCLT---NPPFTAPRNRYPDVRPT-RDPNQP 48
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8483 | NP_650264.1 |
SCP_euk |
37..180 |
CDD:240180 |
7/24 (29%) |
T12A7.10 | NP_001255586.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.