DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and GLIPR1

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:210 Identity:68/210 - (32%)
Similarity:101/210 - (48%) Gaps:41/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TIMIISCEVAFACNGKIIASGITAEERSIILQE----HNRLRQIVATGRYPGQPGAENMREIVWD 71
            |:..|:..|:|..|....|:.:...|....:::    ||:.|..|       :|.|.:|..:.||
Human     4 TLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEV-------KPTASDMLYMTWD 61

  Fly    72 DELAARAQKWADNCQFRHD-----PHRTINRFT-MGQNLAIIWSTAPLDADDGDFP-----SRIQ 125
            ..||..|:.||.||||.|:     ||:....|| :|:|   ||:        |..|     |.|.
Human    62 PALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN---IWT--------GSVPIFSVSSAIT 115

  Fly   126 SWFNEVQKYSFGDAWSPKT-GHYSQLVWGETSLVGCGYAEYKDTSKYNKL-----YVCNYGPGGN 184
            :|::|:|.|.|......|. |||:|:||.::..|||........|.::.|     ::||||||||
Human   116 NWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGN 180

  Fly   185 VVGYNPYEVGKPSCS 199
            ...: ||:.| .:||
Human   181 YPTW-PYKRG-ATCS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 50/163 (31%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 52/163 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40962
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.