DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CRISP3

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:196 Identity:74/196 - (37%)
Similarity:95/196 - (48%) Gaps:43/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRH-DPHRTIN 96
            |..:|.|: .:||.||:.|:       |.|.||.::.|:.|.||.|||||:.|.:|| :|...:.
Human    67 TQVQREIV-NKHNELRRAVS-------PPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMT 123

  Fly    97 RFTMGQNL-----AIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPKT-----GHYSQLV 151
            ....|:||     :..||.|            |||||:|...:.||  ..|||     |||:|:|
Human   124 SLKCGENLYMSSASSSWSQA------------IQSWFDEYNDFDFG--VGPKTPNAVVGHYTQVV 174

  Fly   152 WGETSLVGCG--YAEYKDTSKYNKLYVCNYGPGGNVVG--YNPYEVGKPSCSTYGMKPSSRYQGL 212
            |..:.|||||  |...:...||  .|||.|.|.||...  |.|||.|.|..|.    |.:...||
Human   175 WYSSYLVGCGNAYCPNQKVLKY--YYVCQYCPAGNWANRLYVPYEQGAPCASC----PDNCDDGL 233

  Fly   213 C 213
            |
Human   234 C 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 58/155 (37%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151118
Domainoid 1 1.000 88 1.000 Domainoid score I7923
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40962
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.