DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and LOC101883528

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:175 Identity:59/175 - (33%)
Similarity:89/175 - (50%) Gaps:24/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            :|.:|...|:..||.||..|       ||.|..|:::|||:.:...|:.:|..|.:.|:|  .:.
Zfish    23 LTEQEILNIVDLHNELRSQV-------QPSAAFMQKVVWDETIRLVAEGYAAKCIWDHNP--DLE 78

  Fly    97 RFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD---AWSPKTGHYSQLVWGETSLV 158
            ..|||:||.:  .|.|.:|     ...:..||||...|::..   |.....|||:||||..|:.:
Zfish    79 HLTMGENLFV--GTGPFNA-----TKAVMDWFNENLDYNYNTNDCAEDKMCGHYTQLVWANTTKI 136

  Fly   159 GCG--YAEYKDTSKYNK--LYVCNYGPGGNVVGYNPYEVGKPSCS 199
            ||.  :.:..:...:.|  |.:|:|.|.||:.|..|||.|: |||
Zfish   137 GCASYFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGE-SCS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 45/149 (30%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 45/149 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.