DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CG42713

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster


Alignment Length:50 Identity:13/50 - (26%)
Similarity:22/50 - (44%) Gaps:8/50 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAI 106
            ||:|..:|.  :...||...||:    :|  ..||:..:..:...:|..|
  Fly    23 PGRPSHQNC--LHGKDEGVERAR----HC--NRDPNPQMWYYNQRENRCI 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 12/49 (24%)
CG42713NP_001188736.1 KU <54..89 CDD:294074 1/10 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.