DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and LOC100536500

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:235 Identity:65/235 - (27%)
Similarity:101/235 - (42%) Gaps:40/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TTIMIISCEVAF-----ACNGKIIASGITAEERSI---ILQEHNRLRQIVATGRYPGQPGAENMR 66
            |...::.|.:.|     ||:    .:|:..|..|:   |:..||..|:.|       ||.|.||.
Zfish     9 TMFALVICFLGFLHMSAACS----VTGVCTELSSVQQEIVDVHNAFRRAV-------QPSASNML 62

  Fly    67 EIVWDDELAARAQKWADNCQFRHDP--HRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFN 129
            ::.|.|.:|..|:.|.:.|...|.|  .|.:|.:.||:||   :....:.:    :.|.:.:|.:
Zfish    63 KMSWSDAVAESARGWINKCNMTHGPPSSRMLNGYEMGENL---FKATGISS----WTSVVDAWHS 120

  Fly   130 EVQ--KYSFGDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYE 192
            ||.  ||..|......||||:|:||..:..|||...:...    |..|.|:|...||.....||.
Zfish   121 EVNNYKYPIGSINGQATGHYTQVVWYSSYEVGCAVTQCGS----NYFYGCHYYRAGNFRTVPPYS 181

  Fly   193 VGKPSCSTYGMKPSSRYQGLCAAPGSSPAANSVYGANTIE 232
            :|.|..|.    |::....||.  .:.|..|.....:.::
Zfish   182 LGSPCASC----PNNCEDNLCT--NACPYINGFVNCDALK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 45/149 (30%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.