DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and crispld2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_003199065.1 Gene:crispld2 / 100535149 ZFINID:ZDB-GENE-130131-1 Length:508 Species:Danio rerio


Alignment Length:282 Identity:93/282 - (32%)
Similarity:128/282 - (45%) Gaps:80/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTM 100
            :|..||:.||:||..|       .|.|.||..::|||||...|..||:.||:.|.|...:  .::
Zfish    60 DREEILKLHNKLRGEV-------YPTASNMEYMIWDDELERSATSWAEQCQWEHGPQDLL--MSI 115

  Fly   101 GQNLAIIWSTAPLDADDGDFPS---RIQSWFNEVQKYSFG-----DAWSPK--TG----HYSQLV 151
            |||||:.|         |.:.|   .:|:|::||:.|::.     :.|.|:  :|    ||:|||
Zfish   116 GQNLAVHW---------GRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLV 171

  Fly   152 WGETSLVGCG---------YAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSS 207
            |..|:.|||.         :.|..:.:.|   .||||.|.||.:|..||:.|:| ||.  ..|| 
Zfish   172 WATTNRVGCAVHVCPRMNVWGEIWENAVY---LVCNYSPKGNWIGEAPYQHGRP-CSQ--CPPS- 229

  Fly   208 RYQGLCAAPGSSPAANSVYGANTIETYEYGYNSSPSSQTANNNPPTNNINKSQFSYNQPR---PK 269
             |.|:|       ..|..|..:: |..|              .|..|.:.|.|... |||   ||
Zfish   230 -YGGVC-------RDNLCYKRDS-ERQE--------------TPEMNEVEKPQEPL-QPRTTPPK 270

  Fly   270 PVQTINPNP-SPFNPQAAVPSA 290
            |    .|.| ||..|..|.||:
Zfish   271 P----QPKPSSPKKPANAKPSS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 55/165 (33%)
crispld2XP_003199065.1 SCP_euk 61..206 CDD:240180 55/165 (33%)
LCCL 299..382 CDD:128866
LCCL 402..495 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585658
Domainoid 1 1.000 81 1.000 Domainoid score I8420
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25860
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.