Sequence 1: | NP_650264.1 | Gene: | CG8483 / 41623 | FlyBaseID: | FBgn0038126 | Length: | 392 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017953344.1 | Gene: | r3hdml / 100492715 | XenbaseID: | XB-GENE-1011048 | Length: | 253 | Species: | Xenopus tropicalis |
Alignment Length: | 206 | Identity: | 64/206 - (31%) |
---|---|---|---|
Similarity: | 101/206 - (49%) | Gaps: | 49/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
Fly 97 RFTMGQNLAIIWSTAPLDADDGDFPS---RIQSWFNEVQKYSFGDAWSPK----------TG--- 145
Fly 146 -HYSQLVWGETSLVGC------GYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGM 203
Fly 204 KPSSRYQGLCA 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8483 | NP_650264.1 | SCP_euk | 37..180 | CDD:240180 | 48/165 (29%) |
r3hdml | XP_017953344.1 | CAP_R3HDML | 63..208 | CDD:349409 | 48/165 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 78 | 1.000 | Domainoid score | I8613 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |