DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and r3hdml

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:206 Identity:64/206 - (31%)
Similarity:101/206 - (49%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            |:..:.|.:|..||::|..|.       |.|.||..:|||:.||..|:.||:.|::.|.|:: :.
 Frog    58 ISPRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQ-LM 114

  Fly    97 RFTMGQNLAIIWSTAPLDADDGDFPS---RIQSWFNEVQKYSFGDAWSPK----------TG--- 145
            |: :||||::         ..|.:.|   .::.|::|.|.|||.   .|:          ||   
 Frog   115 RY-IGQNLSV---------HSGRYRSIVDLVKGWYDERQHYSFP---HPRECNPSCPNKCTGAVC 166

  Fly   146 -HYSQLVWGETSLVGC------GYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGM 203
             ||:|:||..::.:||      ....:..|.:.....||||...||.:|..||::|:| ||  ..
 Frog   167 THYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRP-CS--AC 228

  Fly   204 KPSSRYQGLCA 214
            .||  |.|:|:
 Frog   229 PPS--YGGVCS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 48/165 (29%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 48/165 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8613
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.